Top Quality Peptide /Eel Calcitonin CAS 57014-02-5

Model NO.
HB- Elcatonin
Storage
Cool Dried Storage
Grade Standard
Medicine Grade
CAS
57014-02-5
MOQ
1g
Type
Pharmaceutical Intermediates
Shelf Life
2 Years
Transport Package
According to Customer′ S Requiremt
Specification
1kg/2kg/5kg/10kg foil bags 25kgs/ drum or based on
Origin
China
Production Capacity
1000kg/Month
Reference Price
$ 8.10 - 9.00
Contact Us

Product Description

 
Top  Quality Peptide /Eel Calcitonin CAS 57014-02-5
 

Top Quality Peptide /Eel Calcitonin CAS 57014-02-5

Elcatonin is a Calcitonin derivative which is transformed from eel's calcitonin by changing the S-S bond into the stable
C-N bond. It inhibits the absorption and autolysis of bones, thus leads to blood calcium descending. In addition, it inhibits
the bone salts dissolving and transferring and promotes the excretion of calcium and phosphorus in urine. Meanwhile, it
inhibits renal tubules reabsorbing calcium, phosphorus and sodium and keeps blood calcium at normal level. It is mainly used
for remitting or eliminating the pain caused by Osteoporosis
 

Product Name: Elcatonin
Synonyms: THYROCALCITONIN EEL;CALCITONIN, EEL;CSNLSTCVLGKLSQELHKLQTYPRTDVGAGTP-NH2;CSNLSTCVLGKLSQELHKLQTYPRTDVGAGTP-NH2 (DISULFIDE BRIDGE: 1-7);H-CYS-SER-ASN-LEU-SER-THR-CYS-VAL-LEU-GLY-LYS-LEU-SER-GLN-GLU-LEU-HIS-LYS-LEU-GLN-THR-TYR-PRO-ARG-THR-ASP-VAL-GLY-ALA-GLY-THR-PRO-NH2;H-CYS-SER-ASN-LEU-SER-THR-CYS-VAL-LEU-GLY-LYS-LEU-SER-GLN-GLU-LEU-HIS-LYS-LEU-GLN-THR-TYR-PRO-ARG-THR-ASP-VAL-GLY-ALA-GLY-THR-PRO-NH2 (DISULFIDE BRIDGE: 1-7);cys-ser-asn-leu-ser-thr-cys-val-leu-gly-lys-leu-ser-gln-glu-leu-his-lys-leu-gln-thr-tyr-pro-arg-thr-asp-val-gly-ala-gly-thr-pro-nh2 [disulfide bridge: 1-7];miacalcic
CAS: 57014-02-5
MF: C146H241N43O47S2
MW: 3414.87
EINECS: 232-693-2
Product Categories: Peptide ;proteins
Purity: 98%,99%
 

Function

Calcitonin can be used as a drug to treat calcium and phosphorus metabolic disorders, and can be used to treat hypercalcemia,
osteitis deformation, osteoporosis, hyperphosphatemia, ulcer disease, as well as the diagnosis of thyroid myelocellular carcinoma
and lung cancer. Neurodystrophy and calcium, phosphorus metabolic disorders such as hypercalcemia, hyperphosphatemia, ulcer
disease, acute pancreatitis. It is also used to diagnose thyroid and medullary cell carcinoma and lung cancer.

 

Related Products
Thymopentin CAS: 69558-55-0 Linaelotide Acetate CAS: 851199-59-2
Somatostatin CAS: 38916-34-6 Lypressin CAS: 50-57-7
Bivalirudin Trifluoroacetate CAS: 128270-60-0 Nesiritide acetate CAS: 114471-18-0
Eptifibatide CAS: 148031-34-9 Pramlintide Acetate CAS: 196078-30-5
Abarelix Acetate CAS: 183552-38-7 protirelin CAS: 24305-27-9
Antide CAS: 112568-12-4 Secretin CAS: 17034-35-4
Aviptadil Acetate CAS: 40077-57-4 Thymosinα1 CAS: 62304-98-7
Alarelin CAS: 79561-22-1 Teriparatide acetate CAS: 52232-67-4
Angiotensin II CAS: 20071-00-5 Terlipressin CAS: 14636-12-5
Argipressine CAS: 113-79-1 Tetracosactide Acetate /cosyntropin CAS: 16960-16-0
Atosiban CAS: 90779-69-4 Vapreotide Acetate CAS: 103222-11-3
Calcitonin salmon CAS: 47931-85-1 Ziconotide CAS: 107452-89-1
Cetrorelix CAS: 120287-85-6 Goserelin Acetate CAS: 145781-92-6
Carbetocin Acetate CAS: 37025-55-1 Oxytocin CAS: 50-56-6
ANP 1-28 CAS: 89213-87-6 Leuprorelin CAS: 74381-53-6
Deslorelin CAS: 57773-65-6 Desmopressin Acetate CAS: 16679-58-6
Eel calcitonin CAS: 57014-02-5 Liraglutide CAS: 204656-20-2
Eledoisin CAS: 69-25-0 Octreotide acetate CAS: 79517-01-4
Enfuvirtide CAS: 159519-65-0 Semaglutide CAS: 910463-68-2
Exenatide Acetate CAS: 141732-76-5 Triptorelin Acetate CAS: 57773-63-4
Glucagon CAS: 16941-32-5 Lanreotide CAS: 108736-35-2
Gonadorelin acetate CAS: 71447-49-9 Sermorelin CAS: 86168-78-7
Icatibant CAS: 130308-48-4 Palmitoyl Tripeptide-5 CAS: 623172-56-5
Copper tripeptide-1 CAS: 49557-75-7 More......  

 

 
Top Quality Peptide /Eel Calcitonin CAS 57014-02-5
 
 
Our Services

1. New Molecules R&D.

2. Own test center HPLC NMR GC LC-MS.

3. API and Intermediates from China reputed manufacturers.

4. Documents support COA MOA MSDS DMF open part.

Our advantages

1. Government awarded company. Top 100 enterprises in Hebei.

2. Quality warrant. If any quality failure. we 100% return the payment or replacement.

3.More than 14 years experiences in pharmaceutical and chemical international trading.

4.Fast response on customers request and fast shipment.

Shipping  and  Payment
 
 

Our Service


1.Cooperate with research institutions, we strictly control the process from raw material to finished product.
 

2.The customer comes first, we provide reasonable price, high quality product and prompt shipment.
 

3.We can send the goods to your delivery address directly. It is relatively safe and fast. 


4.Quick and clear response to customers questions.
 

5.We could make our price discount if you place a substantial order with us.

Why Choose Us?


1.Full experience of large numbers containers loading in Chinese sea port.


2.Fast shipment by reputed shipping line.


3.Packing with pallet as buyer's special request.


4.Best service after shipment with e mail.


5.Cargoes together with container sales service available.


6.Full experience for Canada & Japan export.


7.Cargoes photo before and after loading into container.


8.Raw materials from Chinese origin.

  FAQ

Q1: Can I get a sample
A:Free samples are available, while the shipping cost should be undertaken by your side.


Q2: What is your MOQ
A:For the high value product, our MOQ starts from 1g and generally starts from 10gs.For other low price product, our MOQ starts from 100g and 1kg.


Q3: Is there any discount
A:Yes, for larger quantity, we always support with better price.


Q4: What payment terms do you accept
A:We'd like to accept T/T, L/C, Western Union or Bitcoin.


Q5: How long will it take to get the goods
A:Depending on your location.For small order, please expect 5-7 days by DHL,UPS,TNT, FEDEX, EMS.For mass order, please allow 5-15 days by Air, 20-35 days by Sea.


Q6: How do you treat quality complaint
A:First of all, our quality control will ensure the product quality in advance. If there is a real quality problem caused by us, we will send you free goods for replacement or refund your loss.

Our Advantages

High quality, competitive price, adequate stock and fast delivery

competitive price.


1. Enterprise standard and 99% purity.


2.We are manufacturer and can provide high quality products with factory price.


3.Safe and fast delivery

1)Parcel can be sent out in 2 working days after payment. tracking number available.

2)Secure and discreet shipment. various transportation methods for your choice.

3)Customs pass rate 99%

Contact us right now for more information about our products and shipping!!!

 
 
 

 

Pharmaceutical Intermediate

LACHAINEDC.COM, 2023